PDB entry 1ata

View 1ata on RCSB PDB site
Description: high-resolution structure of ascaris trypsin inhibitor in solution: direct evidence for a ph induced conformational transition in the reactive site
Class: proteinase inhibitor(trypsin)
Keywords: proteinase inhibitor(trypsin)
Deposited on 1994-05-20, released 1994-08-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ascaris trypsin inhibitor
  Species: Ascaris suum [TaxId:6253]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P19398 (0-61)
  Domains in SCOPe 2.08: d1ataa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ataA (A:)
  eaekctkpneqwtkcggcegtcaqkivpctreckpprceciasagfvrdaqgncikfedc
  pk