PDB entry 1at9

View 1at9 on RCSB PDB site
Description: structure of bacteriorhodopsin at 3.0 angstrom determined by electron crystallography
Class: photoreceptor
Keywords: photoreceptor, proton pump, membrane protein, retinal protein, two-dimensional crystal
Deposited on 1997-08-20, released 1998-09-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: ELECTRONCRYSTALLOGRAPHY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacteriorhodopsin
    Species: Halobacterium salinarum [TaxId:2242]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1at9a_
  • Heterogens: RET

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1at9A (A:)
    eaqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsm
    llgygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimig
    tglvgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvv
    lwsaypvvwligsegagivplnietllfmvldvsakvgfglillrsraifgeaeapepsa
    gdgaaats
    

    Sequence, based on observed residues (ATOM records): (download)
    >1at9A (A:)
    aqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsml
    lgygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigt
    glvgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvl
    wsaypvvwligsegagivplnietllfmvldvsakvgfglillrsraifg