PDB entry 1at5

View 1at5 on RCSB PDB site
Description: hen egg white lysozyme with a succinimide residue
Class: hydrolase
Keywords: succinimide, hydrolase, o-glycosyl hydrolase
Deposited on 1997-08-18, released 1998-02-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.182
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00698 (0-128)
      • modified residue (100-101)
    Domains in SCOPe 2.06: d1at5a_
  • Heterogens: NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1at5A (A:)
    kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins
    rwwcndgrtpgsrnlcnipcsallssditasvncakkivsxxngmnawvawrnrckgtdv
    qawirgcrl