PDB entry 1at5

View 1at5 on RCSB PDB site
Description: hen egg white lysozyme with a succinimide residue
Class: hydrolase
Keywords: succinimide, hydrolase, o-glycosyl hydrolase
Deposited on 1997-08-18, released 1998-02-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: lysozyme
  Species: Gallus gallus [TaxId:9031]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00698 (0-128)
    • modified residue (100-101)
  Domains in SCOPe 2.08: d1at5a_
• Heterogens: NA, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1at5A (A:)
  kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins
  rwwcndgrtpgsrnlcnipcsallssditasvncakkivsxxngmnawvawrnrckgtdv
  qawirgcrl