PDB entry 1at3

View 1at3 on RCSB PDB site
Description: herpes simplex virus type II protease
Class: serine protease
Keywords: serine protease, viral protease, hsv2 protease
Deposited on 1997-08-16, released 1998-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.205
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: herpes simplex virus type II protease
    Species: Human herpesvirus 2 [TaxId:10310]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1at3a_
  • Chain 'B':
    Compound: herpes simplex virus type II protease
    Species: Human herpesvirus 2 [TaxId:10310]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1at3b_
  • Heterogens: DFP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1at3A (A:)
    masaemrerleaplpdravpiyvagflalydsgdpgelaldpdtvraalppenplpinvd
    hrarcevgrvlavvndprgpffvgliacvqlervletaasaaiferrgpalsreerllyl
    itnylpsvslstkrrgdevppdrtlfahvalcaigrrlgtivtydtsldaaiapfrhldp
    atregvrreaaeaelalagrtwapgvealthtllstavnnmmlrdrwslvaerrrqagia
    ghtylqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1at3A (A:)
    ravpiyvagflalydsgdpgelaldpdtvraalppenplpinvdhrarcevgrvlavvnd
    prgpffvgliacvqlervletaasaailsreerllylitnylpsvslstkpdrtlfahva
    lcaigrrlgtivtydtsldaaiapfrhldpatregvrreaaeaelalagrtwapgvealt
    htllstavnnmmlrdrwslvaerrrqagiaghtylqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1at3B (B:)
    masaemrerleaplpdravpiyvagflalydsgdpgelaldpdtvraalppenplpinvd
    hrarcevgrvlavvndprgpffvgliacvqlervletaasaaiferrgpalsreerllyl
    itnylpsvslstkrrgdevppdrtlfahvalcaigrrlgtivtydtsldaaiapfrhldp
    atregvrreaaeaelalagrtwapgvealthtllstavnnmmlrdrwslvaerrrqagia
    ghtylqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1at3B (B:)
    ravpiyvagflalydsgdpgelaldpdtvraalppenplpinvdhrarcevgrvlavvnd
    prgpffvgliacvqlervletaasaailsreerllylitnylpsvslstkpdrtlfahva
    lcaigrrlgtivtydtsldaaiapfrhldpatregvrreaaeaelalagrtwapgvealt
    htllstavnnmmlrdrwslvaerrrqagiaghtylqa