PDB entry 1at0

View 1at0 on RCSB PDB site
Description: 17-kDA fragment of hedgehog C-terminal autoprocessing domain
Class: signaling protein
Keywords: developmental signaling molecule, cholesterol transfer, signaling protein
Deposited on 1997-08-15, released 1997-11-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 17-hedgehog
    Species: Drosophila melanogaster
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1at0a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1at0A (A:)
    cftpestallesgvrkplgelsigdrvlsmtangqavysevilfmdrnleqmqnfvqlht
    dggavltvtpahlvsvwqpesqkltfvfadrieeknqvlvrdvetgelrpqrvvkvgsvr
    skgvvapltregtivvnsvaascya