PDB entry 1at0

View 1at0 on RCSB PDB site
Description: 17-kDA fragment of hedgehog C-terminal autoprocessing domain
Class: signaling protein
Keywords: developmental signaling molecule, cholesterol transfer, signaling protein
Deposited on 1997-08-15, released 1997-11-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 17-hedgehog
  Species: Drosophila melanogaster
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q02936 (0-144)
  Domains in SCOPe 2.08: d1at0a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1at0A (A:)
  cftpestallesgvrkplgelsigdrvlsmtangqavysevilfmdrnleqmqnfvqlht
  dggavltvtpahlvsvwqpesqkltfvfadrieeknqvlvrdvetgelrpqrvvkvgsvr
  skgvvapltregtivvnsvaascya