PDB entry 1asz

View 1asz on RCSB PDB site
Description: the active site of yeast aspartyl-tRNA synthetase: structural and functional aspects of the aminoacylation reaction
Class: complex (aminoacyl-tRNA synthase/tRNA)
Keywords: complex (aminoacyl-tRNA synthase/tRNA)
Deposited on 1995-01-19, released 1995-05-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.203
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ASPARTYL-tRNA SYNTHETASE
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1asza1, d1asza2
  • Chain 'B':
    Compound: ASPARTYL-tRNA SYNTHETASE
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1aszb1, d1aszb2
  • Chain 'R':
    Compound: t-RNA (75-mer)
  • Chain 'S':
    Compound: t-RNA (75-mer)
  • Heterogens: ATP

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aszA (A:)
    edtakdnygklpliqsrdsdrtgqkrvkfvdldeakdsdkevlfrarvhntrqqgatlaf
    ltlrqqasliqglvkankegtisknmvkwagslnlesivlvrgivkkvdepiksatvqnl
    eihitkiytisetpealpilledasrseaeaeaaglpvvnldtrldyrvidlrtvtnqai
    friqagvcelfreylatkkftevhtpkllgapseggssvfevtyfkgkaylaqspqfnkq
    qlivadfervyeigpvfraensnthrhmteftgldmemafeehyhevldtlselfvfifs
    elpkrfaheielvrkqypveefklpkdgkmvrltykegiemlraagkeigdfedlstene
    kflgklvrdkydtdfyildkfpleirpfytmpdpanpkysnsydffmrgeeilsgaqrih
    dhallqermkahglspedpglkdycdgfsygcpphagggiglervvmfyldlknirrasl
    fprdpkrlrp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aszB (B:)
    edtakdnygklpliqsrdsdrtgqkrvkfvdldeakdsdkevlfrarvhntrqqgatlaf
    ltlrqqasliqglvkankegtisknmvkwagslnlesivlvrgivkkvdepiksatvqnl
    eihitkiytisetpealpilledasrseaeaeaaglpvvnldtrldyrvidlrtvtnqai
    friqagvcelfreylatkkftevhtpkllgapseggssvfevtyfkgkaylaqspqfnkq
    qlivadfervyeigpvfraensnthrhmteftgldmemafeehyhevldtlselfvfifs
    elpkrfaheielvrkqypveefklpkdgkmvrltykegiemlraagkeigdfedlstene
    kflgklvrdkydtdfyildkfpleirpfytmpdpanpkysnsydffmrgeeilsgaqrih
    dhallqermkahglspedpglkdycdgfsygcpphagggiglervvmfyldlknirrasl
    fprdpkrlrp
    

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.