PDB entry 1asw

View 1asw on RCSB PDB site
Description: avian sarcoma virus integrase catalytic core domain crystallized from 20% peg 4000, 10% isopropanol, hepes ph 7.5 using selenomethionine substituted protein; data collected at-165 degrees c
Deposited on 1995-08-25, released 1995-11-14
The last revision prior to the SCOP 1.57 freeze date was dated 1995-11-14, with a file datestamp of 1995-11-15.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.139
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.57: d1asw__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1asw_ (-)
  reprglgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwatai
  avlgrpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdkirv
  laegdgfmkriptskqgellakamyalnhfer