PDB entry 1asw

View 1asw on RCSB PDB site
Description: avian sarcoma virus integrase catalytic core domain crystallized from 20% peg 4000, 10% isopropanol, hepes ph 7.5 using selenomethionine substituted protein; data collected at-165 degrees c
Class: DNA integration
Keywords: DNA integration
Deposited on 1995-08-25, released 1995-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.139
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: avian sarcoma virus integrase
    Species: Avian sarcoma virus [TaxId:11876]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03354 (4-End)
      • conflict (23)
      • conflict (53)
      • conflict (107)
      • conflict (118)
      • conflict (129)
      • conflict (145)
    Domains in SCOPe 2.07: d1aswa_
  • Heterogens: EPE, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1aswA (A:)
    plreprglgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwat
    aiavlgrpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdki
    rvlaegdgfmkriptskqgellakamyalnhfergentktnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aswA (A:)
    reprglgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwatai
    avlgrpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdkirv
    laegdgfmkriptskqgellakamyalnhfer