PDB entry 1asu

View 1asu on RCSB PDB site
Description: avian sarcoma virus integrase catalytic core domain crystallized from 2% peg 400, 2m ammonium sulfate, hepes ph 7.5
Deposited on 1995-08-25, released 1995-11-14
The last revision prior to the SCOP 1.71 freeze date was dated 1995-11-14, with a file datestamp of 1995-11-15.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.152
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.71: d1asu__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1asu_ (-)
  plreprglgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwat
  aiavlgrpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdki
  rvlaegdgfmkriptskqgellakamyalnhfergentktnl