PDB entry 1asu

View 1asu on RCSB PDB site
Description: avian sarcoma virus integrase catalytic core domain crystallized from 2% peg 400, 2m ammonium sulfate, hepes ph 7.5
Class: DNA integration
Keywords: DNA integration
Deposited on 1995-08-25, released 1995-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.152
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: avian sarcoma virus integrase
    Species: Avian sarcoma virus [TaxId:11876]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03354 (4-159)
      • conflict (53)
      • conflict (118)
    Domains in SCOPe 2.07: d1asua_
  • Heterogens: EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1asuA (A:)
    plreprglgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwat
    aiavlgrpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdki
    rvlaegdgfmkriptskqgellakamyalnhfergentktnl