PDB entry 1ast

View 1ast on RCSB PDB site
Description: structure of astacin and implications for activation of astacins and zinc-ligation of collagenases
Class: hydrolase(metalloproteinase)
Keywords: hydrolase(metalloproteinase)
Deposited on 1993-04-21, released 1994-07-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.158
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: astacin
  Species: Astacus astacus [TaxId:6715]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07584 (0-199)
  Domains in SCOPe 2.08: d1asta_
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1astA (A:)
  aailgdeylwsggvipytfagvsgadqsailsgmqeleektcirfvprttesdyveifts
  gsgcwsyvgrisgaqqvslqangcvyhgtiihelmhaigfyhehtrmdrdnyvtinyqnv
  dpsmtsnfdidtysryvgedyqyysimhygkysfsiqwgvletivplqngidltdpydka
  hmlqtdanqinnlytnecsl