PDB entry 1ass

View 1ass on RCSB PDB site
Description: apical domain of the chaperonin from thermoplasma acidophilum
Deposited on 1997-08-11, released 1997-12-03
The last revision prior to the SCOP 1.55 freeze date was dated 1997-12-03, with a file datestamp of 1997-12-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.222
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1ass__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ass_ (-)
    msgividkekvhskmpdvvknakialidsaleikkteieakvqisdpskiqdflnqetnt
    fkqmvekikksganvvlcqkgiddvaqhylakegiyavrrvkksdmeklakatgakivtd
    lddltpsvlgeaetveerkigddrmtfvmgck