PDB entry 1asq

View 1asq on RCSB PDB site
Description: x-ray structures and mechanistic implications of three functional derivatives of ascorbate oxidase from zucchini: reduced-, peroxide-, and azide-forms
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 1992-11-25, released 1994-01-31
The last revision prior to the SCOP 1.75 freeze date was dated 1994-01-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.32 Å
R-factor: 0.178
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ascorbate oxidase
    Species: Cucurbita pepo var. melopepo
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1asqa1, d1asqa2, d1asqa3
  • Chain 'B':
    Compound: ascorbate oxidase
    Species: Cucurbita pepo var. melopepo
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1asqb1, d1asqb2, d1asqb3
  • Heterogens: NAG, CU, OH, AZI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1asqA (A:)
    sqirhykweveymfwapncnenivmgingqfpgptiranagdsvvveltnklhtegvvih
    whgilqrgtpwadgtasisqcainpgetffynftvdnpgtffyhghlgmqrsaglygsli
    vdppqgkkepfhydgeinlllsdwwhqsihkqevglsskpirwigepqtillngrgqfdc
    siaakydsnlepcklkgsescapyifhvspkktyririasttalaalnfaignhqllvve
    adgnyvqpfytsdidiysgesysvlittdqnpsenywvsvgtrarhpntppgltllnylp
    nsvsklptspppqtpawddfdrsknftyritaamgspkppvkfnrrifllntqnvingyv
    kwaindvslalpptpylgamkynllhafdqnpppevfpedydidtpptnektrigngvyq
    fkigevvdvilqnanmmkenlsethpwhlhghdfwvlgygdgkfsaeeesslnlknpplr
    ntvvifpygwtairfvadnpgvwafhchiephlhmgmgvvfaegvekvgriptkalacgg
    takslinnpknp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1asqB (B:)
    sqirhykweveymfwapncnenivmgingqfpgptiranagdsvvveltnklhtegvvih
    whgilqrgtpwadgtasisqcainpgetffynftvdnpgtffyhghlgmqrsaglygsli
    vdppqgkkepfhydgeinlllsdwwhqsihkqevglsskpirwigepqtillngrgqfdc
    siaakydsnlepcklkgsescapyifhvspkktyririasttalaalnfaignhqllvve
    adgnyvqpfytsdidiysgesysvlittdqnpsenywvsvgtrarhpntppgltllnylp
    nsvsklptspppqtpawddfdrsknftyritaamgspkppvkfnrrifllntqnvingyv
    kwaindvslalpptpylgamkynllhafdqnpppevfpedydidtpptnektrigngvyq
    fkigevvdvilqnanmmkenlsethpwhlhghdfwvlgygdgkfsaeeesslnlknpplr
    ntvvifpygwtairfvadnpgvwafhchiephlhmgmgvvfaegvekvgriptkalacgg
    takslinnpknp