PDB entry 1asp

View 1asp on RCSB PDB site
Description: x-ray structures and mechanistic implications of three functional derivatives of ascorbate oxidase from zucchini: reduced-, peroxide-, and azide-forms
Deposited on 1992-11-25, released 1994-01-31
The last revision prior to the SCOP 1.57 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.59 Å
R-factor: 0.16
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aspA (A:)
    sqirhykweveymfwapncnenivmgingqfpgptiranagdsvvveltnklhtegvvih
    whgilqrgtpwadgtasisqcainpgetffynftvdnpgtffyhghlgmqrsaglygsli
    vdppqgkkepfhydgeinlllsdwwhqsihkqevglsskpirwigepqtillngrgqfdc
    siaakydsnlepcklkgsescapyifhvspkktyririasttalaalnfaignhqllvve
    adgnyvqpfytsdidiysgesysvlittdqnpsenywvsvgtrarhpntppgltllnylp
    nsvsklptspppqtpawddfdrsknftyritaamgspkppvkfnrrifllntqnvingyv
    kwaindvslalpptpylgamkynllhafdqnpppevfpedydidtpptnektrigngvyq
    fkigevvdvilqnanmmkenlsethpwhlhghdfwvlgygdgkfsaeeesslnlknpplr
    ntvvifpygwtairfvadnpgvwafhchiephlhmgmgvvfaegvekvgriptkalacgg
    takslinnpknp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aspB (B:)
    sqirhykweveymfwapncnenivmgingqfpgptiranagdsvvveltnklhtegvvih
    whgilqrgtpwadgtasisqcainpgetffynftvdnpgtffyhghlgmqrsaglygsli
    vdppqgkkepfhydgeinlllsdwwhqsihkqevglsskpirwigepqtillngrgqfdc
    siaakydsnlepcklkgsescapyifhvspkktyririasttalaalnfaignhqllvve
    adgnyvqpfytsdidiysgesysvlittdqnpsenywvsvgtrarhpntppgltllnylp
    nsvsklptspppqtpawddfdrsknftyritaamgspkppvkfnrrifllntqnvingyv
    kwaindvslalpptpylgamkynllhafdqnpppevfpedydidtpptnektrigngvyq
    fkigevvdvilqnanmmkenlsethpwhlhghdfwvlgygdgkfsaeeesslnlknpplr
    ntvvifpygwtairfvadnpgvwafhchiephlhmgmgvvfaegvekvgriptkalacgg
    takslinnpknp