PDB entry 1asi

View 1asi on RCSB PDB site
Description: crystallization and preliminary x-ray structure solution of rhizomucor meihei aspartic proteinase
Deposited on 1994-09-12, released 1994-12-20
The last revision was dated 1994-12-20, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.201
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence, based on SEQRES records:
    >1asi_ (-)
    aaadgsvdtpgyydfdleeyaipvsigtpgqdflllfdtgssdtwvphkgctksegcvgs
    rffdpsasstfkatnynlnitygtgganglyfedsiaigditvtkqilayvdnvrgptae
    qspnadifldglfgaaypdntameaeygstyntvhvnlykqglissplfsvymntnsgtg
    evvfggvnntllggdiaytdvmsryggyyfwdapvtgitvdgsaavrfsrpqaftidtgt
    nffimpssaaskivkaalpdatetqqgwvvpcasyqnskstisivmqksgsssdtieisv
    pvskmllpvdqsnetcmfiilpdggnqyivgnlflrffvnvydfgnnrigfaplasayen
    e
    

    Sequence, based on observed residues (ATOM records):
    >1asi_ (-)
    svdtpgyydfdleeyaipvsigtpgqdflllfdtgssdtwvphkgctksegcvgsrffdp
    sasstfkatnynlnitygtgganglyfedsiaigditvtkqilayvdnvrgptaeqspna
    difldglfgaaypdntameaeygstyntvhvnlykqglissplfsvymntnsgtgevvfg
    gvnntllggdiaytdvmsryggyyfwdapvtgitvdgsaavrfsrpqaftidtgtnffim
    pssaaskivkaalpdatetqqgwvvpcasyqnskstisivmqksgsssdtieisvpvskm
    llpvdqsnetcmfiilpdggnqyivgnlflrffvnvydfgnnrigfaplasayene
    

  • Chain 'p':
    No sequence available.