PDB entry 1ash

View 1ash on RCSB PDB site
Description: the structure of ascaris hemoglobin domain I at 2.2 angstroms resolution: molecular features of oxygen avidity
Class: oxygen storage
Keywords: oxygen storage
Deposited on 1995-01-06, released 1995-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.179
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin (oxy)
    Species: Ascaris suum [TaxId:6253]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28316 (0-End)
      • conflict (46)
    Domains in SCOPe 2.07: d1asha_
  • Heterogens: HEM, OXY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ashA (A:)
    anktrelcmkslehakvdtsnearqdgidlykhmfenypplrkyfksreeytaedvqndp
    ffakqgqkillachvlcatyddretfnaytrelldrhardhvhmppevwtdfwklfeeyl
    gkkttldeptkqawheigrefakeinkhgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ashA (A:)
    anktrelcmkslehakvdtsnearqdgidlykhmfenypplrkyfksreeytaedvqndp
    ffakqgqkillachvlcatyddretfnaytrelldrhardhvhmppevwtdfwklfeeyl
    gkkttldeptkqawheigrefakeink