PDB entry 1as0

View 1as0 on RCSB PDB site
Description: GTP-gamma-s bound g42v gia1
Class: signal transduction
Keywords: signal transduction, gtpase
Deposited on 1997-08-11, released 1997-11-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.206
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gia1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10824
      • engineered (40)
    Domains in SCOPe 2.07: d1as0a1, d1as0a2
  • Heterogens: MG, SO4, GSP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1as0A (A:)
    gctlsaedkaaverskmidrnlredgekaarevkllllgavesgkstivkqmkiiheagy
    seeeckqykavvysntiqsiiaiiramgrlkidfgdaaraddarqlfvlagaaeegfmta
    elagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvkt
    tgivethftfkdlhfkmfdvggqrserkkwihcfegvtaiifcvalsdydlvlaedeemn
    rmhesmklfdsicnnkwftdtsiilflnkkdlfeekikksplticypeyagsntyeeaaa
    yiqcqfedlnkrkdtkeiythftcatdtknvqfvfdavtdviiknnlkdcglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1as0A (A:)
    revkllllgavesgkstivkqmkiiheagyseeeckqykavvysntiqsiiaiiramgrl
    kidfgdaaraddarqlfvlagaaeegfmtaelagvikrlwkdsgvqacfnrsreyqlnds
    aayylndldriaqpnyiptqqdvlrtrvkttgivethftfkdlhfkmfdvggqrserkkw
    ihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkk
    dlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtkn
    vqfvfdavtdvii