PDB entry 1arz

View 1arz on RCSB PDB site
Description: escherichia coli dihydrodipicolinate reductase in complex with nadh and 2,6 pyridine dicarboxylate
Class: oxidoreductase
Keywords: oxidoreductase, reductase, lysine biosynthesis, nadh binding
Deposited on 1997-08-08, released 1998-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.214
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrodipicolinate reductase
    Species: Escherichia coli [TaxId:83333]
    Gene: DAPB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1arza1, d1arza2
  • Chain 'B':
    Compound: dihydrodipicolinate reductase
    Species: Escherichia coli [TaxId:83333]
    Gene: DAPB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1arzb1, d1arzb2
  • Chain 'C':
    Compound: dihydrodipicolinate reductase
    Species: Escherichia coli [TaxId:83333]
    Gene: DAPB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1arzc1, d1arzc2
  • Chain 'D':
    Compound: dihydrodipicolinate reductase
    Species: Escherichia coli [TaxId:83333]
    Gene: DAPB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1arzd1, d1arzd2
  • Heterogens: PO4, K, NAI, PDC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1arzA (A:)
    mhdanirvaiagaggrmgrqliqaalalegvqlgaaleregssllgsdagelagagktgv
    tvqssldavkddfdvfidftrpegtlnhlafcrqhgkgmvigttgfdeagkqairdaaad
    iaivfaanfsvgvnvmlkllekaakvmgdytdieiieahhrhkvdapsgtalamgeaiah
    aldkdlkdcavysreghtgervpgtigfatvragdivgehtamfadigerleithkassr
    mtfangavrsalwlsgkesglfdmrdvldlnnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1arzA (A:)
    anirvaiagaggrmgrqliqaalalegvqlgaaleregssllgsdagelagagktgvtvq
    ssldavkddfdvfidftrpegtlnhlafcrqhgkgmvigttgfdeagkqairdaaadiai
    vfaanfsvgvnvmlkllekaakvmgdytdieiieahhrhkvdapsgtalamgeaiahald
    kdlkdcavysreghtgervpgtigfatvragdivgehtamfadigerleithkassrmtf
    angavrsalwlsgkesglfdmrdvldlnnl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1arzB (B:)
    mhdanirvaiagaggrmgrqliqaalalegvqlgaaleregssllgsdagelagagktgv
    tvqssldavkddfdvfidftrpegtlnhlafcrqhgkgmvigttgfdeagkqairdaaad
    iaivfaanfsvgvnvmlkllekaakvmgdytdieiieahhrhkvdapsgtalamgeaiah
    aldkdlkdcavysreghtgervpgtigfatvragdivgehtamfadigerleithkassr
    mtfangavrsalwlsgkesglfdmrdvldlnnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1arzB (B:)
    nirvaiagaggrmgrqliqaalalegvqlgaaleregssllgsdagelagagktgvtvqs
    sldavkddfdvfidftrpegtlnhlafcrqhgkgmvigttgfdeagkqairdaaadiaiv
    faanfsvgvnvmlkllekaakvmgdytdieiieahhrhkvdapsgtalamgeaiahaldk
    dlkdcavysreghtgervpgtigfatvragdivgehtamfadigerleithkassrmtfa
    ngavrsalwlsgkesglfdmrdvldlnnl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1arzC (C:)
    mhdanirvaiagaggrmgrqliqaalalegvqlgaaleregssllgsdagelagagktgv
    tvqssldavkddfdvfidftrpegtlnhlafcrqhgkgmvigttgfdeagkqairdaaad
    iaivfaanfsvgvnvmlkllekaakvmgdytdieiieahhrhkvdapsgtalamgeaiah
    aldkdlkdcavysreghtgervpgtigfatvragdivgehtamfadigerleithkassr
    mtfangavrsalwlsgkesglfdmrdvldlnnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1arzC (C:)
    danirvaiagaggrmgrqliqaalalegvqlgaaleregssllgsdagelagagktgvtv
    qssldavkddfdvfidftrpegtlnhlafcrqhgkgmvigttgfdeagkqairdaaadia
    ivfaanfsvgvnvmlkllekaakvmgdytdieiieahhrhkvdapsgtalamgeaiahal
    dkdlkdcavysreghtgervpgtigfatvragdivgehtamfadigerleithkassrmt
    fangavrsalwlsgkesglfdmrdvldlnnl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1arzD (D:)
    mhdanirvaiagaggrmgrqliqaalalegvqlgaaleregssllgsdagelagagktgv
    tvqssldavkddfdvfidftrpegtlnhlafcrqhgkgmvigttgfdeagkqairdaaad
    iaivfaanfsvgvnvmlkllekaakvmgdytdieiieahhrhkvdapsgtalamgeaiah
    aldkdlkdcavysreghtgervpgtigfatvragdivgehtamfadigerleithkassr
    mtfangavrsalwlsgkesglfdmrdvldlnnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1arzD (D:)
    danirvaiagaggrmgrqliqaalalegvqlgaaleregssllgsdagelagagktgvtv
    qssldavkddfdvfidftrpegtlnhlafcrqhgkgmvigttgfdeagkqairdaaadia
    ivfaanfsvgvnvmlkllekaakvmgdytdieiieahhrhkvdapsgtalamgeaiahal
    dkdlkdcavysreghtgervpgtigfatvragdivgehtamfadigerleithkassrmt
    fangavrsalwlsgkesglfdmrdvldlnnl