PDB entry 1ary

View 1ary on RCSB PDB site
Description: crystal structures of cyanide-and triiodide-bound forms of arthromyces ramosus peroxidase at different ph values. perturbations of active site residues and their implication in enzyme catalysis
Deposited on 1995-04-25, released 1996-01-29
The last revision prior to the SCOP 1.59 freeze date was dated 1996-01-29, with a file datestamp of 1996-01-31.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.168
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1ary__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ary_ (-)
    svtcpggqstsnsqccvwfdvlddlqtnfyqgskcespvrkilrivfhdaigfspaltaa
    gqfggggadgsiiahsnielafpanggltdtiealravginhgvsfgdliqfatavgmsn
    cpgsprlefltgrsnssqpsppslipgpgntvtaildrmgdagfspdevvdllaahslas
    qeglnsaifrspldstpqvfdtqfyietllkgttqpgpslgfaeelspfpgefrmrsdal
    lardsrtacrwqsmtssnevmgqryraamakmsvlgfdrnaltdcsdvipsavsnnaapv
    ipggltvddievscpsepfpeiatasgplpslapap