PDB entry 1arv

View 1arv on RCSB PDB site
Description: crystal structures of cyanide-and triiodide-bound forms of arthromyces ramosus peroxidase at different ph values. perturbations of active site residues and their implication in enzyme catalysis
Class: peroxidase (donor:h2o2 oxidoreductase)
Keywords: peroxidase (donor:h2o2 oxidoreductase)
Deposited on 1995-04-25, released 1996-01-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.178
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxidase
    Species: 'Arthromyces ramosus' [TaxId:5451]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1arva_
  • Heterogens: CYN, CA, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1arvA (A:)
    qgpgggggsvtcpggqstsnsqccvwfdvlddlqtnfyqgskcespvrkilrivfhdaig
    fspaltaagqfggggadgsiiahsnielafpanggltdtiealravginhgvsfgdliqf
    atavgmsncpgsprlefltgrsnssqpsppslipgpgntvtaildrmgdagfspdevvdl
    laahslasqeglnsaifrspldstpqvfdtqfyietllkgttqpgpslgfaeelspfpge
    frmrsdallardsrtacrwqsmtssnevmgqryraamakmsvlgfdrnaltdcsdvipsa
    vsnnaapvipggltvddievscpsepfpeiatasgplpslapap
    

    Sequence, based on observed residues (ATOM records): (download)
    >1arvA (A:)
    svtcpggqstsnsqccvwfdvlddlqtnfyqgskcespvrkilrivfhdaigfspaltaa
    gqfggggadgsiiahsnielafpanggltdtiealravginhgvsfgdliqfatavgmsn
    cpgsprlefltgrsnssqpsppslipgpgntvtaildrmgdagfspdevvdllaahslas
    qeglnsaifrspldstpqvfdtqfyietllkgttqpgpslgfaeelspfpgefrmrsdal
    lardsrtacrwqsmtssnevmgqryraamakmsvlgfdrnaltdcsdvipsavsnnaapv
    ipggltvddievscpsepfpeiatasgplpslapap