PDB entry 1arr

View 1arr on RCSB PDB site
Description: relaxation matrix refinement of the solution structure of the arc repressor
Deposited on 1993-08-24, released 1994-01-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1arra_
  • Chain 'B':
    Domains in SCOP 1.55: d1arrb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1arrA (A:)
    mkgmskmpqfnlrwprevldlvrkvaeengrsvnseiyqrvmesfkkegriga
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1arrB (B:)
    mkgmskmpqfnlrwprevldlvrkvaeengrsvnseiyqrvmesfkkegriga