PDB entry 1aro

View 1aro on RCSB PDB site
Description: T7 RNA polymerase complexed with T7 lysozyme
Class: complex (polymerase/hydrolase)
Keywords: transcription, DNA-directed RNA polymerase, hydrolase, glycosidase, complex (polymerase/hydrolase)
Deposited on 1997-08-08, released 1998-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.262
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'L':
    Compound: T7 lysozyme
    Species: Enterobacteria phage T7 [TaxId:10760]
    Gene: T7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1arol_
  • Chain 'P':
    Compound: T7 RNA polymerase
    Species: Enterobacteria phage T7 [TaxId:10760]
    Gene: T7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00573
      • engineered (722)
      • engineered (838)
    Domains in SCOPe 2.07: d1arop_
  • Heterogens: HG

PDB Chain Sequences:

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1aroL (L:)
    marvqfkqrestdaifvhcsatkpsqnvgvreirqwhkeqgwldvgyhfiikrdgtveag
    rdemavgshakgynhnsigvclvggiddkgkfdanftpaqmqslrsllvtllakyegavl
    rahhevapkacpsfdlkrwweknelvtsdrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aroL (L:)
    rvqfkqrestdaifvhcsatkpsqnvgvreirqwhkeqgwldvgyhfiikrdgtveagrd
    emavgshakgynhnsigvclvggiddkgkfdanftpaqmqslrsllvtllakyegavlra
    hhevapkacpsfdlkrwweknelvtsdrg
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1aroP (P:)
    mntiniakndfsdielaaipfntladhygerlareqlalehesyemgearfrkmferqlk
    agevadnaaakplittllpkmiarindwfeevkakrgkrptafqflqeikpeavayitik
    ttlacltsadnttvqavasaigraiedearfgrirdleakhfkknveeqlnkrvghvykk
    afmqvveadmlskgllggeawsswhkedsihvgvrciemliestgmvslhrqnagvvgqd
    setielapeyaeaiatragalagispmfqpcvvppkpwtgitgggywangrrplalvrth
    skkalmryedvympevykainiaqntawkinkkvlavanvitkwkhspvedipaiereel
    pmkpedidmnpealtawkraaaavyrkdkarksrrislefmleqankfanhkaiwfpynm
    dwrgrvyavsmfnpqgndmtkglltlakgkpigkegyywlkihgancagvdkvpfperik
    fieenhenimacaksplentwwaeqdspfcflafcfeyagvqhhglsyncslplafdgsc
    sgiqhfsamlrdevggravnllpsetvqdiygivakkvneilqadaingtdnevvtvtde
    ntgeisekvklgtkalagqwlaygvtrsvtkrsvmtlaygskefgfrqqvledtiqpaid
    sgkglmftqpnqaagymakliwesvsvtvvaaveamnwlksaakllaaevkdkktgeilr
    krsavhwvtpdgfpvwqeykkpiqtrlnlmflgqfrlqptintnkdseidahkqesgiap
    nfvhsqdgshlrktvvwahekygiesfalihdsfgtipadaanlfkavretmvdtyessd
    vladfydqfadqlhesqldkmpalpakgnlnlrdilesdfafa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aroP (P:)
    kndfsdielaaipfntladhygerlareqlalehesyemgearfrkmferqllittllpk
    miarindwfeevkakrgkrptafqflqeikpeavayitikttlacltsadnttvqavasa
    igraiedearfgrirdleakhfkkfmqvveadmlskgllggeawsswhkedsihvgvrci
    emliestgmvslhrqnsetielapeyaeaiatragalagispmfqpcvvppkpwtgitgg
    gywangrrplalvrthskkalmryedvympevykainiaqntawkinkkvlavanvitkw
    vyrkdkarksrrislefmleqankfanhkaiwfpynmdwrgrvyavsmfnpqgndmtkgl
    ltlakgkpigkegyywlkihgancagvdkvpfperikfieenhenimacaksplentwwa
    eqdspfcflafcfeyagvqhhglsyncslplafdgscsgiqhfsamlrdevggravnllp
    setvqdiygivakkvneilqadainggtkalagqwlaygvtrsvtkrsvmtlaygskefg
    frqqvledtiqpaidsgkglmftqpnqaagymakliwesvsvtvvaaveamnwlksaakl
    laaevkdkktgeilrkrsavhwvtpdgfpvwqeykkpiqtrlnlmflgqfrlqptintnk
    dseidahkqesgiapnfvhsqdgshlrktvvwahekygiesfalihdsfgtipadaanlf
    kavretmvdtyessdvladfydqfadqlhesqldkmpalpakgnlnlrdilesd