PDB entry 1ark

View 1ark on RCSB PDB site
Description: sh3 domain from human nebulin, nmr, 15 structures
Class: transferase
Keywords: transferase, sh3 domain, nebulin, z-disk assembly, actin-binding
Deposited on 1997-08-07, released 1998-01-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nebulin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1arka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1arkA (A:)
    tagkiframydymaadadevsfkdgdaiinvqaidegwmygtvqrtgrtgmlpanyveai