PDB entry 1arc

View 1arc on RCSB PDB site
Description: the primary structure and structural characteristics of achromobacter lyticus protease I, a lysine-specific serine protease
Class: hydrolase/hydrolase inhibitor
Keywords: SERINE PROTEASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 1993-04-15, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.152
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: achromobacter protease I
    Species: Achromobacter lyticus [TaxId:224]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1arca_
  • Heterogens: TCK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1arcA (A:)
    gvsgscnidvvcpegdgrrdiiravgaysksgtlactgslvnntandrkmyfltahhcgm
    gtastaasivvywnyqnstcrapntpasgangdgsmsqtqsgstvkatyatsdftlleln
    naanpafnlfwagwdrrdqnypgaiaihhpnvaekrisnstsptsfvawgggagtthlnv
    qwqpsggvtepgssgspiyspekrvlgqlhggpsscsatgtnrsdqygrvftswtgggaa
    asrlsdwldpastgaqfidgldsgggtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1arcA (A:)
    gvsgscnidvvcpegdgrrdiiravgaysksgtlactgslvnntandrkmyfltahhcgm
    gtastaasivvywnyqnstcrapntpasgangdgsmsqtqsgstvkatyatsdftlleln
    naanpafnlfwagwdrrdqnypgaiaihhpnvaekrisnstsptsfvawgggagtthlnv
    qwqpsggvtepgssgspiyspekrvlgqlhggpsscsatgtnrsdqygrvftswtgggaa
    asrlsdwldpastgaqfidglds