PDB entry 1arb

View 1arb on RCSB PDB site
Description: the primary structure and structural characteristics of achromobacter lyticus protease i, a lysine-specific serine protease
Deposited on 1993-04-15, released 1993-10-31
The last revision prior to the SCOP 1.59 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.2 Å
R-factor: 0.149
AEROSPACI score: 0.83 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1arb__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1arb_ (-)
    gvsgscnidvvcpegdgrrdiiravgaysksgtlactgslvnntandrkmyfltahhcgm
    gtastaasivvywnyqnstcrapntpasgangdgsmsqtqsgstvkatyatsdftlleln
    naanpafnlfwagwdrrdqnypgaiaihhpnvaekrisnstsptsfvawgggagtthlnv
    qwqpsggvtepgssgspiyspekrvlgqlhggpsscsatgtnrsdqygrvftswtgggaa
    asrlsdwldpastgaqfidglds