PDB entry 1arb

View 1arb on RCSB PDB site
Description: the primary structure and structural characteristics of achromobacter lyticus protease I, a lysine-specific serine protease
Class: hydrolase(serine protease)
Keywords: hydrolase(serine protease)
Deposited on 1993-04-15, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.149
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: achromobacter protease I
    Species: Achromobacter lyticus [TaxId:224]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1arba_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1arbA (A:)
    gvsgscnidvvcpegdgrrdiiravgaysksgtlactgslvnntandrkmyfltahhcgm
    gtastaasivvywnyqnstcrapntpasgangdgsmsqtqsgstvkatyatsdftlleln
    naanpafnlfwagwdrrdqnypgaiaihhpnvaekrisnstsptsfvawgggagtthlnv
    qwqpsggvtepgssgspiyspekrvlgqlhggpsscsatgtnrsdqygrvftswtgggaa
    asrlsdwldpastgaqfidgldsgggtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1arbA (A:)
    gvsgscnidvvcpegdgrrdiiravgaysksgtlactgslvnntandrkmyfltahhcgm
    gtastaasivvywnyqnstcrapntpasgangdgsmsqtqsgstvkatyatsdftlleln
    naanpafnlfwagwdrrdqnypgaiaihhpnvaekrisnstsptsfvawgggagtthlnv
    qwqpsggvtepgssgspiyspekrvlgqlhggpsscsatgtnrsdqygrvftswtgggaa
    asrlsdwldpastgaqfidglds