PDB entry 1ar5

View 1ar5 on RCSB PDB site
Description: x-ray structure of the cambialistic superoxide dismutase from propionibacterium shermanii active with fe or mn
Class: oxidoreductase
Keywords: superoxide dismutase, oxidoreductase, degrades o2-, dismutase
Deposited on 1997-08-09, released 1997-11-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.163
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: Propionibacterium freudenreichii subsp. shermanii [TaxId:1752]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ar5a1, d1ar5a2
  • Chain 'B':
    Compound: superoxide dismutase
    Species: Propionibacterium freudenreichii subsp. shermanii [TaxId:1752]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ar5b1, d1ar5b2
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ar5A (A:)
    avytlpelpydysalepyisgeimelhhdkhhkayvdgantaldklaeardkadfgaink
    lekdlafnlaghvnhsvfwknmapkgsaperptdelgaaideffgsfdnmkaqftaaatg
    iqgsgwaslvwdplgkrintlqfydhqnnlpagsipllqldmwehafylqyknvkgdyvk
    swwnvvnwddvalrfsearva
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ar5B (B:)
    avytlpelpydysalepyisgeimelhhdkhhkayvdgantaldklaeardkadfgaink
    lekdlafnlaghvnhsvfwknmapkgsaperptdelgaaideffgsfdnmkaqftaaatg
    iqgsgwaslvwdplgkrintlqfydhqnnlpagsipllqldmwehafylqyknvkgdyvk
    swwnvvnwddvalrfsearva