PDB entry 1ar3

View 1ar3 on RCSB PDB site
Description: complex of aconitase s642a mutant with isocitrate
Deposited on 1997-08-08, released 1997-11-12
The last revision was dated 1997-11-12, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.171
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain
  • Heterogens: FS4, ICT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence, based on SEQRES records:
    >1ar3_ (-)
    qrakvamshfepheyirydlleknidivrkrlnrpltlsekivyghlddpanqeiergkt
    ylrlrpdrvamqdataqmamlqfissglpkvavpstihcdhlieaqlggekdlrrakdin
    qevynflatagakygvgfwrpgsgiihqiilenyaypgvlligtdshtpnggglggicig
    vggadavdvmagipwelkcpkvigvkltgslsgwtspkdvilkvagiltvkggtgaivey
    hgpgvdsisctgmaticnmgaeigattsvfpynhrmkkylsktgradianladefkdhlv
    pdpgchydqvieinlselkphingpftpdlahpvaevgsvaekegwpldirvgligsctn
    ssyedmgrsaavakqalahglkcksqftitpgseqiratierdgyaqvlrdvggivlana
    cgpcigqwdrkdikkgekntivtsynrnftgrndanpethafvtspeivtalaiagtlkf
    npetdfltgkdgkkfkleapdadelpraefdpgqdtyqhppkdssgqrvdvsptsqrlql
    lepfdkwdgkdledlqilikvkgkcttdhisaagpwlkfrghldnisnnlligainienr
    kansvrnavtqefgpvpdtaryykqhgirwvvigdenygegasrehsaleprhlggraii
    tksfarihetnlkkqgllpltfadpadynkihpvdkltiqglkdfapgkplkciikhpng
    tqetillnhtfnetqiewfragsalnrmkelqqk
    

    Sequence, based on observed residues (ATOM records):
    >1ar3_ (-)
    rakvamshfepheyirydlleknidivrkrlnrpltlsekivyghlddpanqeiergkty
    lrlrpdrvamqdataqmamlqfissglpkvavpstihcdhlieaqlggekdlrrakdinq
    evynflatagakygvgfwrpgsgiihqiilenyaypgvlligtdshtpnggglggicigv
    ggadavdvmagipwelkcpkvigvkltgslsgwtspkdvilkvagiltvkggtgaiveyh
    gpgvdsisctgmaticnmgaeigattsvfpynhrmkkylsktgradianladefkdhlvp
    dpgchydqvieinlselkphingpftpdlahpvaevgsvaekegwpldirvgligsctns
    syedmgrsaavakqalahglkcksqftitpgseqiratierdgyaqvlrdvggivlanac
    gpcigqwdrkdikkgekntivtsynrnftgrndanpethafvtspeivtalaiagtlkfn
    petdfltgkdgkkfkleapdadelpraefdpgqdtyqhppkdssgqrvdvsptsqrlqll
    epfdkwdgkdledlqilikvkgkcttdhisaagpwlkfrghldnisnnlligainienrk
    ansvrnavtqefgpvpdtaryykqhgirwvvigdenygegasrehsaleprhlggraiit
    ksfarihetnlkkqgllpltfadpadynkihpvdkltiqglkdfapgkplkciikhpngt
    qetillnhtfnetqiewfragsalnrmkelqqk
    

  • Chain 'p':
    No sequence available.