PDB entry 1ar2

View 1ar2 on RCSB PDB site
Description: disulfide-free immunoglobulin fragment
Class: immunoglobulin
Keywords: disulfide-free, immunoglobulin fragment, bence-jones
Deposited on 1997-08-08, released 1997-11-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.28
AEROSPACI score: -1.86 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rei
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01607 (2-108)
      • engineered (24)
      • engineered (33)
    Domains in SCOPe 2.06: d1ar2a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ar2A (A:)
    tpdiqmtqspsslsasvgdrvtitvqasqdiikhlnwyqqtpgkapklliyeasnlqagv
    psrfsgsgsgtdytftisslqpediatyycqqyqslpytfgqgtklqit