PDB entry 1ar2

View 1ar2 on RCSB PDB site
Description:
Deposited on 1997-08-08, released 1997-11-12
The last revision prior to the SCOP 1.67 freeze date was dated 1997-11-12, with a file datestamp of 1997-11-12.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.28
AEROSPACI score: -1.86 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1ar2__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ar2_ (-)
    tpdiqmtqspsslsasvgdrvtitvqasqdiikhlnwyqqtpgkapklliyeasnlqagv
    psrfsgsgsgtdytftisslqpediatyycqqyqslpytfgqgtklqit