PDB entry 1ar0

View 1ar0 on RCSB PDB site
Description: nuclear transport factor 2 (ntf2) e42k mutant
Class: transport
Keywords: transport, nuclear transport protein
Deposited on 1997-08-08, released 1997-12-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.2
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nuclear transport factor 2
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61972
      • engineered (41)
    Domains in SCOPe 2.07: d1ar0a_
  • Chain 'B':
    Compound: nuclear transport factor 2
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61972
      • engineered (41)
    Domains in SCOPe 2.07: d1ar0b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ar0A (A:)
    mgdkpiweqigssfiqhyyqlfdndrtqlgaiyidascltwkgqqfqgkaaiveklsslp
    fqkiqhsitaqdhqptpdsciismvvgqlkadedpimgfhqmfllknindawvctndmfr
    lalhnfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ar0A (A:)
    gdkpiweqigssfiqhyyqlfdndrtqlgaiyidascltwkgqqfqgkaaiveklsslpf
    qkiqhsitaqdhqptpdsciismvvgqlkadedpimgfhqmfllknindawvctndmfrl
    alhnf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ar0B (B:)
    mgdkpiweqigssfiqhyyqlfdndrtqlgaiyidascltwkgqqfqgkaaiveklsslp
    fqkiqhsitaqdhqptpdsciismvvgqlkadedpimgfhqmfllknindawvctndmfr
    lalhnfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ar0B (B:)
    kpiweqigssfiqhyyqlfdndrtqlgaiyidascltwkgqqfqgkaaiveklsslpfqk
    iqhsitaqdhqptpdsciismvvgqlkadedpimgfhqmfllknindawvctndmfrlal
    h