PDB entry 1aqz

View 1aqz on RCSB PDB site
Description: crystal structure of a highly specific aspergillus ribotoxin, restrictocin
Class: ribotoxin
Keywords: ribotoxin, ribosome-inactivating protein, protein-RNA specific interaction, laue diffraction, cell-entry activity
Deposited on 1997-08-04, released 1997-11-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.237
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: restrictocin
    Species: Aspergillus restrictus [TaxId:5064]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P67876 (0-148)
      • conflict (114)
    Domains in SCOPe 2.07: d1aqza_
  • Chain 'B':
    Compound: restrictocin
    Species: Aspergillus restrictus [TaxId:5064]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P67876 (0-148)
      • conflict (114)
    Domains in SCOPe 2.07: d1aqzb_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1aqzA (A:)
    atwtcinqqlnpktnkwedkrllysqakaesnshhaplsdgktgssyphwftngydgngk
    likgrtpikfgkadcdrppkhsqngmgkddhyllefptfpdghdykfdskkpkenpgpar
    viytypnkvfcgivahqrgnqgdlrlcsh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aqzA (A:)
    atwtcinqqledkrllysqakaesnshhaplsdgktgssyphwftngydgngklikgrtp
    ikfgkadcdrppkhsqngmgkddhyllefptfpdghdykfdskkpkenpgparviytypn
    kvfcgivahqrgnqgdlrlcsh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1aqzB (B:)
    atwtcinqqlnpktnkwedkrllysqakaesnshhaplsdgktgssyphwftngydgngk
    likgrtpikfgkadcdrppkhsqngmgkddhyllefptfpdghdykfdskkpkenpgpar
    viytypnkvfcgivahqrgnqgdlrlcsh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aqzB (B:)
    atwtcinqqlwedkrllysqakaesnshhaplsdgktgssyphwftngydgngklikgrt
    pikfgkadcdrppkhsqngmgkddhyllefptfpdghdykfdskkpkenpgparviytyp
    nkvfcgivahqrgnqgdlrlcsh