PDB entry 1aqw

View 1aqw on RCSB PDB site
Description: glutathione s-transferase in complex with glutathione
Class: transferase/substrate
Keywords: TRANSFERASE, GLUTATHIONE S-TRANSFERASE, CLASS PI, transferase-substrate complex
Deposited on 1997-08-03, released 1998-03-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-12-21, with a file datestamp of 2011-12-16.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.20600000000000002
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase
    Species: Homo sapiens [TaxId:9606]
    Gene: GTP_HUMAN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1aqwa1, d1aqwa2
  • Chain 'B':
    Compound: glutathione s-transferase
    Species: Homo sapiens [TaxId:9606]
    Gene: GTP_HUMAN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1aqwb1, d1aqwb2
  • Chain 'C':
    Compound: glutathione s-transferase
    Species: Homo sapiens [TaxId:9606]
    Gene: GTP_HUMAN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1aqwc1, d1aqwc2
  • Chain 'D':
    Compound: glutathione s-transferase
    Species: Homo sapiens [TaxId:9606]
    Gene: GTP_HUMAN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1aqwd1, d1aqwd2
  • Heterogens: GSH, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aqwA (A:)
    ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
    tlyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvk
    alpgqlkpfetllsqnqggktfivgdqisfadynlldlllihevlapgcldafpllsayv
    grlsarpklkaflaspeyvnlpingngkq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aqwB (B:)
    ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
    tlyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvk
    alpgqlkpfetllsqnqggktfivgdqisfadynlldlllihevlapgcldafpllsayv
    grlsarpklkaflaspeyvnlpingngkq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aqwC (C:)
    ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
    tlyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvk
    alpgqlkpfetllsqnqggktfivgdqisfadynlldlllihevlapgcldafpllsayv
    grlsarpklkaflaspeyvnlpingngkq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aqwD (D:)
    ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
    tlyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvk
    alpgqlkpfetllsqnqggktfivgdqisfadynlldlllihevlapgcldafpllsayv
    grlsarpklkaflaspeyvnlpingngkq