PDB entry 1aqu

View 1aqu on RCSB PDB site
Description: estrogen sulfotransferase with bound inactive cofactor pap and 17-beta estradiol
Deposited on 1997-08-01, released 1998-10-28
The last revision prior to the SCOP 1.63 freeze date was dated 1998-10-28, with a file datestamp of 1998-10-28.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.218
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1aqua_
  • Chain 'B':
    Domains in SCOP 1.63: d1aqub_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1aquA (A:)
    eyyevfgefrgvlmdkrftkywedvemflarpddlviatypksgttwisevvymiykegd
    vekckedaifnripylecrnedlingikqlkekesprivkthlppkllpasfweknckmi
    ylcrnakdvavsyyyfllmitsypnpksfsefvekfmqgqvpygswydhvkawwekskns
    rvlfmfyedmkedirrevvklieflerkpsaelvdriiqhtsfqemknnpstnytmmpee
    mmnqkvspfmrkgiigdwknhfpealrerfdehykqqmkdctvkfrme
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aquA (A:)
    eyyevfgefrgvlmdkrftkywedvemflarpddlviatypksgttwisevvymiykegd
    aifnripylecrnedlingikqlkekesprivkthlppkllpasfweknckmiylcrnak
    dvavsyyyfllmitsypnpksfsefvekfmqgqvpygswydhvkawweksknsrvlfmfy
    edmkedirrevvklieflerkpsaelvdriiqhtsfqemknnpstnytmmpeemmnqkvs
    pfmrkgiigdwknhfpealrerfdehykqqmkdctvkfrme
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1aquB (B:)
    eyyevfgefrgvlmdkrftkywedvemflarpddlviatypksgttwisevvymiykegd
    vekckedaifnripylecrnedlingikqlkekesprivkthlppkllpasfweknckmi
    ylcrnakdvavsyyyfllmitsypnpksfsefvekfmqgqvpygswydhvkawwekskns
    rvlfmfyedmkedirrevvklieflerkpsaelvdriiqhtsfqemknnpstnytmmpee
    mmnqkvspfmrkgiigdwknhfpealrerfdehykqqmkdctvkfrm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aquB (B:)
    eyyevfgefrgvlmdkrftkywedvemflarpddlviatypksgttwisevvymiykeed
    aifnripylecrnedlingikqlkekesprivkthlppkllpasfweknckmiylcrnak
    dvavsyyyfllmitsypnpksfsefvekfmqgqvpygswydhvkawweksknsrvlfmfy
    edmkedirrevvklieflerkpsaelvdriiqhtsfqemknnpstnytmmpeemmnqkvs
    pfmrkgiigdwknhfpealrerfdehykqqmkdctvkfrm