PDB entry 1aqt

View 1aqt on RCSB PDB site
Description: epsilon subunit of f1f0-atp synthase from escherichia coli
Deposited on 1997-07-31, released 1998-02-04
The last revision prior to the SCOP 1.57 freeze date was dated 1998-02-04, with a file datestamp of 1998-02-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.214
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1aqt_ (-)
styhldvvsaeqqmfsglvekiqvtgsegelgiypghaplltaikpgmirivkqhgheef
iylsggilevqpgnvtvladtairgqdldearameakrkaeehissshgdvdyaqasael
akaiaqlrvieltkk