PDB entry 1aqn

View 1aqn on RCSB PDB site
Description: subtilisin mutant 8324
Class: serine protease
Keywords: hydrolase, serine proteinase, serine protease
Deposited on 1997-07-31, released 1998-01-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.139
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: subtilisin 8324
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00782 (0-274)
      • engineered (21)
      • engineered (49)
      • engineered (86)
      • engineered (168)
      • engineered (205)
      • engineered (216-217)
    Domains in SCOPe 2.07: d1aqna_
  • Heterogens: CA, UNX, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aqnA (A:)
    aqsvpygvsqikapalhsqgycgsnvkvavidsgidsshpdlkvaggasfvpsetnpfqd
    nnshgthvagtvaalnnsigvlgvapcaslyavkvlgadgsgqyswiingiewaiannmd
    vinmslggpsgsaalkaavdkavasgvvvvaaagnegtsgssstvgypakypsviavgav
    dssnqrasfssvgpeldvmapgvsicstlpgnkygaksgtsmasphvagaaalilskhpn
    wtntqvrsslentttklgdsfyygkglinvqaaaq