PDB entry 1aqm

View 1aqm on RCSB PDB site
Description:
Deposited on 1997-07-31, released 1999-03-02
The last revision prior to the SCOP 1.55 freeze date was dated 1999-03-02, with a file datestamp of 1999-03-02.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.157
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1aqm_1, d1aqm_2

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aqm_ (-)
    tpttfvhlfewnwqdvaqeceqylgpkgyaavqvsppnehitgsqwwtryqpvsyelqsr
    ggnraqfidmvnrcsaagvdiyvdtlinhmaagsgtgtagnsfgnksfpiyspqdfhesc
    tinnsdygndryrvqncelvgladldtasnyvqntiaayindlqaigvkgfrfdaskhva
    asdiqslmakvngspvvfqevidqggeavgaseylstglvtefkystelgntfrngslaw
    lsnfgegwgfmpsssavvfvdnhdnqrghggagnvitfedgrlydlanvfmlaypygypk
    vmssydfhgdtdaggpnvpvhnngnlecfasnwkcehrwsyiaggvdfrnntadnwavtn
    wwdntnnqisfgrgssghmainkedstltatvqtdmasgqycnvlkgelsadakscsgev
    itvnsdgtinlnigawdamaihknakln