PDB entry 1aqm

View 1aqm on RCSB PDB site
Description: alpha-amylase from alteromonas haloplanctis complexed with tris
Class: hydrolase
Keywords: alpha-amylase, alpha-1,4-glucan-4-glucanohydrolase, beta-alpha-eight barrel, psychrophilic enzyme, glycosidase inhibition, hydrolase
Deposited on 1997-07-31, released 1999-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.157
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-amylase
    Species: Pseudoalteromonas haloplanktis [TaxId:228]
    Gene: AMY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1aqma1, d1aqma2
  • Heterogens: CA, CL, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1aqmA (A:)
    tpttfvhlfewnwqdvaqeceqylgpkgyaavqvsppnehitgsqwwtryqpvsyelqsr
    ggnraqfidmvnrcsaagvdiyvdtlinhmaagsgtgtagnsfgnksfpiyspqdfhesc
    tinnsdygndryrvqncelvgladldtasnyvqntiaayindlqaigvkgfrfdaskhva
    asdiqslmakvngspvvfqevidqggeavgaseylstglvtefkystelgntfrngslaw
    lsnfgegwgfmpsssavvfvdnhdnqrghggagnvitfedgrlydlanvfmlaypygypk
    vmssydfhgdtdaggpnvpvhnngnlecfasnwkcehrwsyiaggvdfrnntadnwavtn
    wwdntnnqisfgrgssghmainkedstltatvqtdmasgqycnvlkgelsadakscsgev
    itvnsdgtinlnigawdamaihknaklntssas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aqmA (A:)
    tpttfvhlfewnwqdvaqeceqylgpkgyaavqvsppnehitgsqwwtryqpvsyelqsr
    ggnraqfidmvnrcsaagvdiyvdtlinhmaagsgtgtagnsfgnksfpiyspqdfhesc
    tinnsdygndryrvqncelvgladldtasnyvqntiaayindlqaigvkgfrfdaskhva
    asdiqslmakvngspvvfqevidqggeavgaseylstglvtefkystelgntfrngslaw
    lsnfgegwgfmpsssavvfvdnhdnqrghggagnvitfedgrlydlanvfmlaypygypk
    vmssydfhgdtdaggpnvpvhnngnlecfasnwkcehrwsyiaggvdfrnntadnwavtn
    wwdntnnqisfgrgssghmainkedstltatvqtdmasgqycnvlkgelsadakscsgev
    itvnsdgtinlnigawdamaihknakln