PDB entry 1aql

View 1aql on RCSB PDB site
Description: crystal structure of bovine bile-salt activated lipase complexed with taurocholate
Class: hydrolase
Keywords: hydrolase, serine esterase, lipid degradation, glycoprotein
Deposited on 1997-07-30, released 1998-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-24, with a file datestamp of 2011-08-19.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.211
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bile-salt activated lipase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1aqla_
  • Chain 'B':
    Compound: bile-salt activated lipase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1aqlb_
  • Heterogens: NAG, TCH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aqlA (A:)
    aklgsvyteggfvegvnkklslfgdsidifkgipfaaapkalekperhpgwqgtlkaksf
    kkrclqatltqdstygnedclylniwvpqgrkevshdlpvmiwiyggaflmgasqganfl
    snylydgeeiatrgnvivvtfnyrvgplgflstgdsnlpgnyglwdqhmaiawvkrniea
    fggdpdnitlfgesaggasvslqtlspynkglikraisqsgvglcpwaiqqdplfwakri
    aekvgcpvddtskmagclkitdpraltlayklplgsteypklhylsfvpvidgdfipddp
    vnlyanaadvdyiagtndmdghlfvgmdvpainsnkqdvteedfyklvsgltvtkglrga
    natyevytepwaqdssqetrkktmvdletdilfliptkiavaqhkshaksantytylfsq
    psrmpiypkwmgadhaddlqyvfgkpfatplgyraqdrtvskamiaywtnfartgdpntg
    hstvpanwdpytleddnyleinkqmdsnsmklhlrtnylqfwtqtyqalptv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aqlB (B:)
    aklgsvyteggfvegvnkklslfgdsidifkgipfaaapkalekperhpgwqgtlkaksf
    kkrclqatltqdstygnedclylniwvpqgrkevshdlpvmiwiyggaflmgasqganfl
    snylydgeeiatrgnvivvtfnyrvgplgflstgdsnlpgnyglwdqhmaiawvkrniea
    fggdpdnitlfgesaggasvslqtlspynkglikraisqsgvglcpwaiqqdplfwakri
    aekvgcpvddtskmagclkitdpraltlayklplgsteypklhylsfvpvidgdfipddp
    vnlyanaadvdyiagtndmdghlfvgmdvpainsnkqdvteedfyklvsgltvtkglrga
    natyevytepwaqdssqetrkktmvdletdilfliptkiavaqhkshaksantytylfsq
    psrmpiypkwmgadhaddlqyvfgkpfatplgyraqdrtvskamiaywtnfartgdpntg
    hstvpanwdpytleddnyleinkqmdsnsmklhlrtnylqfwtqtyqalptv