PDB entry 1aqk

View 1aqk on RCSB PDB site
Description: three-dimensional structure of a human fab with high affinity for tetanus toxoid
Class: immunoglobulin
Keywords: human fab, anti-tetanus toxoid, high affinity, crystal packing motif, programming propensity to crystallize, immunoglobulin
Deposited on 1997-07-30, released 1998-02-04
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.185
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: fab b7-15a2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857 (1-225)
      • conflict (29)
      • conflict (32-33)
      • conflict (49)
      • conflict (51)
      • conflict (56-57)
      • conflict (79-80)
      • conflict (87)
      • conflict (92)
      • insertion (98-99)
      • conflict (100-103)
      • conflict (105)
      • conflict (107-108)
      • conflict (111)
      • conflict (117)
      • conflict (157)
      • conflict (219)
    Domains in SCOPe 2.03: d1aqkh1, d1aqkh2
  • Chain 'L':
    Compound: fab b7-15a2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01842 (2-215)
      • conflict (16-17)
      • conflict (22)
      • conflict (24-25)
      • conflict (32-33)
      • conflict (39-40)
      • conflict (50)
      • conflict (52-53)
      • conflict (63)
      • conflict (80)
      • conflict (92)
      • conflict (98-99)
      • conflict (103)
      • conflict (105)
      • conflict (159)
      • conflict (166)
      • conflict (212)
    Domains in SCOPe 2.03: d1aqkl1, d1aqkl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aqkH (H:)
    evqlvesgggvvqpgrslrlscaasgftfnnyaihwvrqapgkglewvafisydgsknyy
    adsvkgrftisrdnskntlflqmnslrpedtaiyycarvlfqqlvlyapfdiwgqgtmvt
    vssastkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aqkL (L:)
    envltqppsvsgapgqrvtisctgsnsnigagftvhwyqhlpgtapkllifantnrpsgv
    pdrfsgsksgtsaslaitglqaedeadyycqsydsslsarfgggtrltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvnagvettkpskqsnnkyaass
    ylsltpeqwkshksyscqvthegstvektvapaecs