PDB entry 1aqk

View 1aqk on RCSB PDB site
Description:
Deposited on 1997-07-30, released 1998-02-04
The last revision prior to the SCOP 1.55 freeze date was dated 1998-02-04, with a file datestamp of 1998-02-04.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.185
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1aqkh1, d1aqkh2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1aqkl1, d1aqkl2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aqkH (H:)
    evqlvesgggvvqpgrslrlscaasgftfnnyaihwvrqapgkglewvafisydgsknyy
    adsvkgrftisrdnskntlflqmnslrpedtaiyycarvlfqqlvlyapfdiwgqgtmvt
    vssastkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aqkL (L:)
    envltqppsvsgapgqrvtisctgsnsnigagftvhwyqhlpgtapkllifantnrpsgv
    pdrfsgsksgtsaslaitglqaedeadyycqsydsslsarfgggtrltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvnagvettkpskqsnnkyaass
    ylsltpeqwkshksyscqvthegstvektvapaecs