PDB entry 1aqj

View 1aqj on RCSB PDB site
Description: structure of adenine-n6-DNA-methyltransferase taqi
Class: methyltransferase
Keywords: methyltransferase, transferase, restriction system, DNA methylation, sinefungin
Deposited on 1996-07-25, released 1997-02-12
The last revision prior to the SCOP 1.73 freeze date was dated 1997-02-12, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.2
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenine-n6-DNA-methyltransferase taqi
    Species: THERMUS AQUATICUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1aqja1, d1aqja2
  • Chain 'B':
    Compound: adenine-n6-DNA-methyltransferase taqi
    Species: THERMUS AQUATICUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1aqjb1, d1aqjb2
  • Heterogens: SFG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1aqjA (A:)
    mglppllslpsnsaprslgrvetppevvdfmvslaeaprggrvlepacahgpflrafrea
    hgtgyrfvgveidpkaldlppwaegiladfllwepgeafdlilgnppygivgeaskypih
    vfkavkdlykkafstwkgkynlygaflekavrllkpggvlvfvvpatwlvledfallref
    laregktsvyylgevfpqkkvsavvirfqksgkglslwdtqesesgftpilwaeyphweg
    eiirfeteetrkleisgmplgdlfhirfaarspefkkhpavrkepgpglvpvltgrnlkp
    gwvdyeknhsglwmpkerakelrdfyatphlvvahtkgtrvvaawderaypwreefhllp
    kegvrldpsslvqwlnseamqkhvrtlyrdfvphltlrmlerlpvrreygfhtspesarn
    f
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aqjA (A:)
    vetppevvdfmvslaeaprggrvlepacahgpflrafreahgtgyrfvgveidpkaldlp
    pwaegiladfllwepgeafdlilgnppygivavkdlykkafstwkgkynlygaflekavr
    llkpggvlvfvvpatwlvledfallreflaregktsvyylgevfpqkkvsavvirfqksg
    kglslwdtqesesgftpilwaeyphwegeiirfeteetrkleisgmplgdlfhirfaars
    pefkkhpavrkepgpglvpvltgrnlkpgwvdyeknhsglwmpkerakelrdfyatphlv
    vahtkgtrvvaawderaypwreefhllpkegvrldpsslvqwlnseamqkhvrtlyrdfv
    phltlrmlerlpvrreygfht
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1aqjB (B:)
    mglppllslpsnsaprslgrvetppevvdfmvslaeaprggrvlepacahgpflrafrea
    hgtgyrfvgveidpkaldlppwaegiladfllwepgeafdlilgnppygivgeaskypih
    vfkavkdlykkafstwkgkynlygaflekavrllkpggvlvfvvpatwlvledfallref
    laregktsvyylgevfpqkkvsavvirfqksgkglslwdtqesesgftpilwaeyphweg
    eiirfeteetrkleisgmplgdlfhirfaarspefkkhpavrkepgpglvpvltgrnlkp
    gwvdyeknhsglwmpkerakelrdfyatphlvvahtkgtrvvaawderaypwreefhllp
    kegvrldpsslvqwlnseamqkhvrtlyrdfvphltlrmlerlpvrreygfhtspesarn
    f
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aqjB (B:)
    vetppevvdfmvslaeaprggrvlepacahgpflrafreahgtgyrfvgveidpkaldlp
    pwaegiladfllwepgeafdlilgnppygivfkavkdlykkafstwkgkynlygafleka
    vrllkpggvlvfvvpatwlvledfallreflaregktsvyylgevfpqkkvsavvirfqk
    sgkglslwdtqesesgftpilwaeyphwegeiirfeteetrkleisgmplgdlfhirfaa
    rspefkkhpavrkepgpglvpvltgrnlkpgwvdyeknhsglwmpkerakelrdfyatph
    lvvahtkgtrvvaawderaypwreefhllpkegvrldpsslvqwlnseamqkhvrtlyrd
    fvphltlrmlerlpvrreygfht