PDB entry 1aqf

View 1aqf on RCSB PDB site
Description: pyruvate kinase from rabbit muscle with mg, k, and l-phospholactate
Deposited on 1997-07-29, released 1998-09-16
The last revision prior to the SCOP 1.57 freeze date was dated 2001-07-04, with a file datestamp of 2001-07-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.196
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aqfA (A:)
    iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtaev
    elkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgpdf
    lvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvh
    evrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    iigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelarssshstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aqfB (B:)
    iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtaev
    elkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgpdf
    lvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvh
    evrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    iigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelarssshstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aqfC (C:)
    iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtaev
    elkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgpdf
    lvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvh
    evrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    iigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelarssshstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aqfD (D:)
    iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtaev
    elkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgpdf
    lvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvh
    evrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    iigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelarssshstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1aqfE (E:)
    iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtaev
    elkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgpdf
    lvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvh
    evrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    iigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelarssshstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aqfE (E:)
    iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpepgaavdlpavsekd
    iqdlkfgveqdvdmvfasfirkaadvhevrkilgekgknikiiskienhegvrrfdeile
    asdgimvargdlgieipaekvflaqkmiigrcnragkpvicatqmlesmikkprptraeg
    sdvanavldgadcimlsgetakgdypleavrmqhliareaeaamfhrklfeelarssshs
    tdlmeamamgsveasykclaaalivltesgrsahqvaryrprapiiavtrnhqtarqahl
    yrgifpvvckdpvqeawaedvdlrvnlamnvgkargffkkgdvvivltgwrpgsgftntm
    rvvpvp
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aqfF (F:)
    iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtaev
    elkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgpdf
    lvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvh
    evrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    iigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelarssshstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aqfG (G:)
    iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtaev
    elkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgpdf
    lvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvh
    evrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    iigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelarssshstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aqfH (H:)
    iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtaev
    elkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgpdf
    lvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvh
    evrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    iigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelarssshstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp