PDB entry 1aqc

View 1aqc on RCSB PDB site
Description: x11 ptb domain-10mer peptide complex
Class: complex (peptide binding module/peptide)
Keywords: complex (peptide binding module/peptide), peptide binding module, ptb domain
Deposited on 1997-07-28, released 1997-12-24
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.21
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: x11
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02410 (1-End)
      • conflict (31-32)
      • conflict (43)
      • conflict (62)
      • conflict (85-86)
      • conflict (106)
      • conflict (135)
    Domains in SCOPe 2.02: d1aqca_
  • Chain 'B':
    Compound: x11
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02410 (Start-171)
      • conflict (31-32)
      • conflict (43)
      • conflict (85-86)
      • conflict (106)
      • conflict (135)
    Domains in SCOPe 2.02: d1aqcb_
  • Chain 'C':
    Compound: peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 1AQC (0-9)
  • Chain 'D':
    Compound: peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 1AQC (0-9)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1aqcA (A:)
    medlidgiifaanylgstqllsdktpsknvrmmqaqeavsrikmaqklaksrkkapeges
    qpmtevdlfiltqrikvlnadtqetmmdhplrtisyiadignivvlmarrriprsnsqen
    veashpsqdgkrqykmichvfesedaqliaqsigqafsvayqeflranginp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aqcA (A:)
    medlidgiifaanylgstqllsdktpsknvrmmqaqeavsrikmaqklmtevdlfiltqr
    ikvlnadtqetmmdhplrtisyiadignivvlmarrrykmichvfesedaqliaqsigqa
    fsvayqeflr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1aqcB (B:)
    medlidgiifaanylgstqllsdktpsknvrmmqaqeavsrikmaqklaksrkkapeges
    qpmtevdlfiltqrikvlnadtqetmmdhplrtisyiadignivvlmarrriprsnsqen
    veashpsqdgkrqykmichvfesedaqliaqsigqafsvayqeflranginp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aqcB (B:)
    iifaanylgstqllnvrmmqaqeavsrikmaqklatevdlfiltqrikvlnadtqetmmd
    hplrtisyiadignivvlmarrrykmichvfesedaqliaqsigqafsvayqeflrangi
    np
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.