PDB entry 1aqc

View 1aqc on RCSB PDB site
Description: x11 ptb domain-10mer peptide complex
Deposited on 1997-07-28, released 1997-12-24
The last revision prior to the SCOP 1.55 freeze date was dated 1997-12-24, with a file datestamp of 1997-12-24.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.21
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1aqca_
  • Chain 'B':
    Domains in SCOP 1.55: d1aqcb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1aqcA (A:)
    medlidgiifaanylgstqllsdktpsknvrmmqaqeavsrikmaqklaksrkkapeges
    qpmtevdlfiltqrikvlnadtqetmmdhplrtisyiadignivvlmarrriprsnsqen
    veashpsqdgkrqykmichvfesedaqliaqsigqafsvayqeflr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aqcA (A:)
    medlidgiifaanylgstqllsdktpsknvrmmqaqeavsrikmaqklmtevdlfiltqr
    ikvlnadtqetmmdhplrtisyiadignivvlmarrrykmichvfesedaqliaqsigqa
    fsvayqeflr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1aqcB (B:)
    iifaanylgstqllsdktpsknvrmmqaqeavsrikmaqklaksrkkapegesqpmtevd
    lfiltqrikvlnadtqetmmdhplrtisyiadignivvlmarrriprsnsqenveashps
    qdgkrqykmichvfesedaqliaqsigqafsvayqeflranginp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aqcB (B:)
    iifaanylgstqllnvrmmqaqeavsrikmaqklatevdlfiltqrikvlnadtqetmmd
    hplrtisyiadignivvlmarrrykmichvfesedaqliaqsigqafsvayqeflrangi
    np