PDB entry 1aqb

View 1aqb on RCSB PDB site
Description: retinol-binding protein (rbp) from pig plasma
Class: retinol transport
Keywords: retinol transport, retinoids, vitamin a, cadmium ion
Deposited on 1997-07-28, released 1998-01-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 1.6500000000000001 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: retinol-binding protein
    Species: Sus scrofa domestica [TaxId:9825]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1aqba_
  • Heterogens: CD, RTL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1aqbA (A:)
    erdcrvssfrvkenfdkarfsgtwyamakkdpeglflqdnivaefsvdenghmsatakgr
    vrllnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwiidtdydtyavqysc
    rlqnldgtcadsysfvfardphgfspevqkivrqrqeelclarqyriithngycdgkser
    nil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aqbA (A:)
    erdcrvssfrvkenfdkarfsgtwyamakkdpeglflqdnivaefsvdenghmsatakgr
    vrllnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwiidtdydtyavqysc
    rlqnldgtcadsysfvfardphgfspevqkivrqrqeelclarqyriithngycd