PDB entry 1aqa

View 1aqa on RCSB PDB site
Description: solution structure of reduced microsomal rat cytochrome b5, nmr, minimized average structure
Deposited on 1997-07-28, released 1997-09-17
The last revision prior to the SCOP 1.67 freeze date was dated 1997-09-17, with a file datestamp of 1997-09-17.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.67: d1aqa__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download) 
    >1aqa_ (-)
dkdvkyytleeiqkhkdskstwvilhhkvydltkfleehpggeevlreqaggdatenfed
vghstdarelsktyiigelhpddrskiakpsetl

    Sequence, based on observed residues (ATOM records): (download) 
    >1aqa_ (-)
kyytleeiqkhkdskstwvilhhkvydltkfleehpggeevlreqaggdatenfedvghs
tdarelsktyiigelhpddrskia