PDB entry 1aqa

View 1aqa on RCSB PDB site
Description: solution structure of reduced microsomal rat cytochrome b5, nmr, minimized average structure
Class: electron transport
Keywords: cytochrome b5, protein recognition, solution structures, secondary structures, electron transport
Deposited on 1997-07-28, released 1997-09-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome b5
    Species: Rattus norvegicus [TaxId:10116]
    Gene: CYB5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1aqaa_
  • Heterogens: HEM

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1aqaA (A:)
    dkdvkyytleeiqkhkdskstwvilhhkvydltkfleehpggeevlreqaggdatenfed
    vghstdarelsktyiigelhpddrskiakpsetl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aqaA (A:)
    kyytleeiqkhkdskstwvilhhkvydltkfleehpggeevlreqaggdatenfedvghs
    tdarelsktyiigelhpddrskia