PDB entry 1aqa

View 1aqa on RCSB PDB site
Description: solution structure of reduced microsomal rat cytochrome b5, nmr, minimized average structure
Class: electron transport
Keywords: cytochrome b5, protein recognition, solution structures, secondary structures, electron transport
Deposited on 1997-07-28, released 1997-09-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome b5
  Species: Rattus norvegicus [TaxId:10116]
  Gene: CYB5
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00173
  Domains in SCOPe 2.08: d1aqaa_
• Heterogens: HEM

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1aqaA (A:)
  dkdvkyytleeiqkhkdskstwvilhhkvydltkfleehpggeevlreqaggdatenfed
  vghstdarelsktyiigelhpddrskiakpsetl
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1aqaA (A:)
  kyytleeiqkhkdskstwvilhhkvydltkfleehpggeevlreqaggdatenfedvghs
  tdarelsktyiigelhpddrskia