PDB entry 1aq7

View 1aq7 on RCSB PDB site
Description: trypsin with inhibitor aeruginosin 98-b
Class: hydrolase/hydrolase inhibitor
Keywords: hydrolase, serine protease, inhibitor, hydrolase-hydrolase inhibitor complex
Deposited on 1997-08-07, released 1998-02-25
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.164
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1aq7a_
  • Chain 'B':
    Compound: aeruginosin 98-b
    Database cross-references and differences (RAF-indexed):
    • PDB 1AQ7 (0-3)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aq7A (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'B':
    No sequence available.